Tirzepatide
Lots & Certificates
Each released lot has one certificate of analysis. Check the lot number printed on your vial against this list.
Product Information
It is not for human consumption. Use only in a laboratory setting by qualified personnel. The FDA has not evaluated this product for safety or efficacy. Any other use is strictly prohibited.
LL-37 (Cathelicidin) Peptide Specifications
The only human cathelicidin, LL-37 is a 37-residue peptide cleaved from the C-terminus of the human cathelicidin antimicrobial protein (hCAP18).
Chemical Properties and Registry Information
| Property | Value |
| Name and synonyms | Cathelicidin (human), hCAP18 (37-residue C-terminal fragment), FALL-39 |
| Material category | Antimicrobial Peptide |
| Sequence | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH |
| Molecular formula | C205H340N60O53 |
| Average molecular mass | 4493.33 g/mol |
| CAS Registry Number | 204646-31-9 |
| PubChem CID | CID 16132337 |
| Structural features | Linear peptide, 37 amino acids. Forms an amphipathic alpha-helix. |
| Appearance | White to off-white lyophilised powder |
| Solubility | Soluble in sterile water or dilute aqueous buffers. |
| Physical form | Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
Note: Registry values apply only to the specific molecular entity, sequence, termini, and material form. Batch records take precedence over family-level literature identifiers.
Research Background and Published Evidence
Published research
LL-37 has been studied in vitro in membrane-interaction, microbial, innate-immune, and cell-signalling systems. Its conformation and measured response vary strongly with ionic strength, matrix composition, peptide concentration, and aggregation state.
Current scientific understanding
The cited mechanistic studies do not authenticate this batch or establish human-use outcomes. Results are highly model- and condition-dependent and cannot be transferred between LL-37, precursor hCAP18, fragments, or modified analogues.
Technical Comparison
| Aspect | This catalogue material | Comparator |
| Identity | Mature human LL-37 sequence, 37 residues | hCAP18: longer human cathelicidin precursor from which LL-37 is proteolytically released |
| Structural distinction | Defined C-terminal 37-residue processed peptide | hCAP18 includes an N-terminal cathelin domain and is not analytically interchangeable with LL-37 |
| Analytical implication | Confirm intact mass, sequence, purity, terminal form, counter-ion, and aggregation profile | Functional assay overlap cannot distinguish full-length LL-37 from fragments, scrambled controls, or aggregates |
Quality and Testing
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot, or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin, and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Laboratory Handling and Storage
Store and handle only under the conditions stated on the product label, batch CoA, and SDS. Keep the container secured, correctly identified, and protected from contamination. Do not infer storage, solvent compatibility, or stability from a related compound.
Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment, and waste disposal should follow the applicable SDS and the institution’s approved procedures.
Regulatory and Legal Status
Research-use notice: This material is supplied exclusively by Alma Research Labs for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements.
